PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00043447001
Common NameGSBRNA2T00043447001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 600aa    MW: 66487.8 Da    PI: 6.9402
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00043447001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260123.21.3e-38389487199
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++ e++r da++slvyeA+ r+rdP+yG++g i++lq+++++l
  GSBRNA2T00043447001 389 PCAACKLLRRRCAEECPFSPYFSPHEPHKFAAVHKVFGASNVSKMLLEVGESQRGDAANSLVYEANLRLRDPIYGCMGAISALQHHIQSL 478
                          7***************************************************************************************** PP

               DUF260  91 kaelallke 99 
                          ++el ++++
  GSBRNA2T00043447001 479 QSELTAVRT 487
                          ****99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
HamapMF_0310023.80524409IPR027520Structure-specific endonuclease subunit Slx1
PROSITE profilePS5016419.41327109IPR000305GIY-YIG nuclease superfamily
SMARTSM004651.3E-428121IPR000305GIY-YIG nuclease superfamily
CDDcd104551.18E-5328102No hitNo description
PfamPF015412.6E-1430102IPR000305GIY-YIG nuclease superfamily
SuperFamilySSF827713.4E-531101IPR000305GIY-YIG nuclease superfamily
PROSITE profilePS5089125.142388489IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-39389486IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006310Biological ProcessDNA recombination
GO:0090305Biological Processnucleic acid phosphodiester bond hydrolysis
GO:0033557Cellular ComponentSlx1-Slx4 complex
GO:0017108Molecular Function5'-flap endonuclease activity
Sequence ? help Back to Top
Protein Sequence    Length: 600 aa     Download sequence    Send to blast
MREKRGRREN PKTLDPVGED GAVIGKEFFA CYILTSLSPR HKGHTYIGFT VNPRRRIRQH  60
NGEITSGAYR TKKKRPWEMV LCIYGFPTKV SALQFEWAWQ HPRESLAVRE AAAAFKSISG  120
LASNIKLAYT MLSLPAWNSL NLTVNYFSSK YAHHGGLSPS LPPHMEVHVC PMDDLPCFTK  180
EDNNSQQEDE DSPDSNEEED DDDSGNQSQP GNPTSSYSLD RRCEKRKGPG TVLDDRLANF  240
TGFGLLDESD EDEVSIEAME KEPETVFNDR LANFIGFGLE KIVEDKVSHC STMEKDCWRR  300
SNFVTSTTEV EVIDLMTPSP TCRVGSSMKR PRVSEFIDLT SREGFGDYYK IVKKVKKDPT  360
FEKTMDHAVM GIRRHVAVPP GTTLNTVTPC AACKLLRRRC AEECPFSPYF SPHEPHKFAA  420
VHKVFGASNV SKMLLEVGES QRGDAANSLV YEANLRLRDP IYGCMGAISA LQHHIQSLQS  480
ELTAVRTDIL RHKYREAATI TSPQNNNNNF NNTTTTSVSD HAALAATILL PPPLPPPHPP  540
RPPRLLSSQP APPVSLPSPS MVVPSSNSSA ANSMYNPPPS SAAGCSNSLS SDNNVHYFD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xm5_A1e-23271509136Structure-specific endonuclease subunit SLX1
4xlg_A1e-23271509136Structure-specific endonuclease subunit SLX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15374RRRIRQHNGEITSGAYRTKKKR
2220226RRCEKRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.51150.0flower| seed
Functional Description ? help Back to Top
Source Description
UniProtCatalytic subunit of a heterodimeric structure-specific endonuclease that resolves DNA secondary structures generated during DNA repair and recombination. Has endonuclease activity towards branched DNA substrates, introducing single-strand cuts in duplex DNA close to junctions with ss-DNA. {ECO:0000256|HAMAP-Rule:MF_03100}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00043447001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013647185.10.0PREDICTED: uncharacterized protein LOC106352042
RefseqXP_013643597.10.0PREDICTED: uncharacterized protein LOC106348406
TrEMBLA0A078GWZ60.0A0A078GWZ6_BRANA; Structure-specific endonuclease subunit SLX1 homolog
STRINGBra021627.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.15e-99LOB domain-containing protein 13
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]